PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.069500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 292aa    MW: 33525.8 Da    PI: 7.0913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.069500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l+++++  G g+W++ ++  g+ R++k+c++rw +yl
   Cucsa.069500.1 14 RGRWTAEEDDKLKKYIEANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding543.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++Ede ++++++ lG++ W++Ia +++ gRt++++k++w+++l
   Cucsa.069500.1  67 RGNISPQEDETILKLHTTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.148961IPR017930Myb domain
SuperFamilySSF466892.87E-2811108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002498.5E-151461IPR001005SANT/Myb domain
CDDcd001674.43E-81661No hitNo description
PROSITE profilePS5129424.3562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2565116IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001676.05E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRTPCCEKE GLRRGRWTAE EDDKLKKYIE ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRTDLKRGNI SPQEDETILK LHTTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSKKIYSDT  120
KKDSPQKPTT SKRGRPNNKQ QTVIAKKKKK KTIPSEESCQ SNSIPETTTT NKPKEEEEEH  180
ATTSSSSEKE PSKNDHNNKN STTKDPKIEE EHWDFTTDDG EKLEKEVIST IIESGEWFYS  240
AWPSSNFNNE WMNWDWESDG VLGQNVQEQP SSWFWANNSN DNNTNGGEEC R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_J2e-22141332120MYB3
3zqc_G2e-22141332120MYB3
3zqc_D2e-22141332120MYB3
3zqc_A2e-22141332120MYB3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819240.0LN681924.1 Cucumis melo genomic scaffold, anchoredscaffold00047.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150080.10.0PREDICTED: transcription repressor MYB6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.15e-69myb domain protein 12